Recombinant Human Orexin Receptor 1 Protein

Recombinant Human Orexin Receptor 1 Protein

Cat. No.: DPP-001038

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥ 98% by HPLC
Nature Recombinant
Target Information
Gene Name HCRTR1
UniProt No. O43613
Gene ID 3061
Alternative Names HCRTR 1; HCRTR1; Hypocretin receptor type 1; Orexin Receptor 1; Orexin receptor type 1; Ox-1-R; Ox1-R; Ox1r; OX1R_HUMAN
Function Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Seems to be exclusively coupled to the G(q) subclass of heteromeric G proteins, which activates the phospholipase C mediated signaling cascade.
Cellular Localization Cell membrane.
Protein Length Full length protein
Sequence MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLI AAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICL PASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICH PLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFS VCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGT TSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYAN SAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSL SLQSRCSISKISEHVVLTSVTTVLP,Belongs to the G-protein coupled receptor 1 family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo
Contact Info
Copyright © Ace Metabolism. All Rights Reserved.
Top