Recombinant Human Orexin Receptor 2 Protein

Recombinant Human Orexin Receptor 2 Protein

Cat. No.: DPP-001039

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Wheat germ
Format Liquid
Purity ≥ 98% by HPLC
Nature Recombinant
Target Information
Gene Name HCRTR2
UniProt No. O43614
Gene ID 3062
Molecular Weight 32 kDa including tags
Alternative Names Hcr tr2; Hcrt receptor 2; Hcrtr2; Hypocretin (orexin) receptor 2; Hypocretin receptor 2; Hypocretin receptor type 2; Orexin 2 receptor; Orexin A/Orexin B receptor; Orexin receptor 2; Orexin receptor type 2; Orexin type 2 receptor; Ox-2-R; Ox2-R; Ox2r; OX2R_HUMAN; Type 2 hypocretin receptor; Type 2 orexin receptor
Function Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Cellular Localization Cell membrane.
Protein Length Protein fragment
Sequence MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHP KEYE,Belongs to the G-protein coupled receptor 1 family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo
Contact Info
Copyright © Ace Metabolism. All Rights Reserved.
Top